GNA15 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16866T
Article Name: GNA15 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16866T
Supplier Catalog Number: CNA16866T
Alternative Catalog Number: MBL-CNA16866T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 112-374 of human GNA15 (NP_002059.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 2769
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: HASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVRDSVLA
Target: GNA15
Application Dilute: WB: WB,1:500 - 1:2000