Huntingtin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16872T
Article Name: Huntingtin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16872T
Supplier Catalog Number: CNA16872T
Alternative Catalog Number: MBL-CNA16872T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 435-635 of human Huntingtin (NP_002102.4).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 348kDa
NCBI: 3064
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PVLSRKQKGKVLLGEEEALEDDSESRSDVSSSALTASVKDEISGELAASSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAHLLKNM
Target: HTT
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200