Myelin Protein Zero (MPZ) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1687S
Article Name: Myelin Protein Zero (MPZ) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1687S
Supplier Catalog Number: CNA1687S
Alternative Catalog Number: MBL-CNA1687S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-153 of human Myelin Protein Zero (MPZ) (P25189).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 4359
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTR
Target: MPZ
Application Dilute: WB: WB,1:500 - 1:1000