IFNA10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16880T
Article Name: IFNA10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16880T
Supplier Catalog Number: CNA16880T
Alternative Catalog Number: MBL-CNA16880T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human IFNA10 (NP_002162.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 3446
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW
Target: IFNA10
Application Dilute: WB: WB,1:500 - 1:2000