[KO Validated] CDK2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16885T
Article Name: [KO Validated] CDK2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16885T
Supplier Catalog Number: CNA16885T
Alternative Catalog Number: MBL-CNA16885T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-298 of human CDK2 (NP_001789.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 1017
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Target: CDK2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:500|IP,1:500 - 1:1000