Collagen I/COL1A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16891P
Article Name: Collagen I/COL1A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16891P
Supplier Catalog Number: CNA16891P
Alternative Catalog Number: MBL-CNA16891P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human Collagen I/COL1A1 (NP_000079.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 139kDa
NCBI: 1277
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF
Target: COL1A1
Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:2000 - 1:10000|IF/ICC,1:50 - 1:200