LAMP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16894S1
Article Name: LAMP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16894S1
Supplier Catalog Number: CNA16894S1
Alternative Catalog Number: MBL-CNA16894S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LAMP1 (NP_005552.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 3916
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: DKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNT
Target: LAMP1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IHC-P,1:50 - 1:200