Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA16900T
| Article Name: |
Insulin Receptor Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA16900T |
| Supplier Catalog Number: |
CNA16900T |
| Alternative Catalog Number: |
MBL-CNA16900T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IP, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1281-1382 of human INSR (NP_000199.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
156kDa |
| NCBI: |
3643 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
PTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS |
| Target: |
INSR |
| Application Dilute: |
WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000 |
