Lamin B1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16910T
Article Name: Lamin B1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16910T
Supplier Catalog Number: CNA16910T
Alternative Catalog Number: MBL-CNA16910T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 397-586 of human Lamin B1 (NP_005564.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 4001
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
Target: LMNB1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200