MAD2/MAD2L1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16911T
Article Name: MAD2/MAD2L1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16911T
Supplier Catalog Number: CNA16911T
Alternative Catalog Number: MBL-CNA16911T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human MAD2/MAD2/MAD2L1 (NP_002349.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 4085
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Target: MAD2L1
Application Dilute: WB: WB,1:500 - 1:2000