PDHA2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16944T
Article Name: PDHA2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16944T
Supplier Catalog Number: CNA16944T
Alternative Catalog Number: MBL-CNA16944T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of mouse PDHA2 (NP_032837.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 18598
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ISYRSREEVHNVRSKSDPIMLLRERIISNNLSNIEELKEIDADVKKEVEDAAQFATTDPEPAVEDIANYLYHQDPPFEVRGAHKWLKYKSHS
Target: Pdha2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200