PNN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16955T
Article Name: PNN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16955T
Supplier Catalog Number: CNA16955T
Alternative Catalog Number: MBL-CNA16955T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PNN (NP_002678.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 5411
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQES
Target: PNN
Application Dilute: WB: WB,1:500 - 1:2000