SFSWAP Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA16973T
Article Name: SFSWAP Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA16973T
Supplier Catalog Number: CNA16973T
Alternative Catalog Number: MBL-CNA16973T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 170-280 of human SFSWAP (NP_004583.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 105kDa
NCBI: 6433
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SKQREKNEAENLEENEEPFVAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSG
Target: SFSWAP
Application Dilute: WB: WB,1:500 - 1:2000