ZNF711 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17008T
Article Name: ZNF711 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17008T
Supplier Catalog Number: CNA17008T
Alternative Catalog Number: MBL-CNA17008T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ZNF711 (NP_001317503.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 7552
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SEDYLMISLDDVGEKLEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAEDDVEIGGTEIVTESEYTSGHSVAGVLDQSRMQREKMVYMAVKDSSQ
Target: ZNF711
Application Dilute: WB: WB,1:500 - 1:2000