ACOX3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17020T
Article Name: ACOX3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17020T
Supplier Catalog Number: CNA17020T
Alternative Catalog Number: MBL-CNA17020T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human ACOX3 (NP_001095137).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 78kDa
NCBI: 8310
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: TALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSP
Target: ACOX3
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200