AXIN2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17022T
Article Name: AXIN2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17022T
Supplier Catalog Number: CNA17022T
Alternative Catalog Number: MBL-CNA17022T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human AXIN2 (NP_004646.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 94kDa
NCBI: 8313
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EDEEREGSELTLNSREGAPTQHPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPAAASPGACPLL
Target: AXIN2
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200