Histone H4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17024T
Article Name: Histone H4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17024T
Supplier Catalog Number: CNA17024T
Alternative Catalog Number: MBL-CNA17024T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: All, Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4 (NP_003529.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 8359
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Target: H4C1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200