PXR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17038P
Article Name: PXR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17038P
Supplier Catalog Number: CNA17038P
Alternative Catalog Number: MBL-CNA17038P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 135-230 of human PXR (NP_003880.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 8856
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: TQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPAD
Target: NR1I2
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500