CD9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1703P
Article Name: CD9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1703P
Supplier Catalog Number: CNA1703P
Alternative Catalog Number: MBL-CNA1703P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 112-195 of human CD9 (NP_001760.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 928
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI
Target: CD9
Application Dilute: WB: WB,1:2000 - 1:8000|IHC-P,1:50 - 1:200