ENAH Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17932T
Article Name: ENAH Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17932T
Supplier Catalog Number: CNA17932T
Alternative Catalog Number: MBL-CNA17932T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 412-591 of human ENAH (NP_001008493.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 55740
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: FPSGGNAIGVNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA
Target: ENAH
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200