RPL35A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17938T
Article Name: RPL35A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17938T
Supplier Catalog Number: CNA17938T
Alternative Catalog Number: MBL-CNA17938T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human RPL35A (NP_000987.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 6165
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: IFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRS
Target: RPL35A
Application Dilute: WB: WB,1:500 - 1:2000