RALGDS Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17963T
Article Name: RALGDS Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17963T
Supplier Catalog Number: CNA17963T
Alternative Catalog Number: MBL-CNA17963T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 771-902 of human RALGDS (NP_001258705).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 101kDa
NCBI: 5900
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: CNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLPRMKQKGLKIAKGIF
Target: RALGDS
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200