MT-ND2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17968P
Article Name: MT-ND2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17968P
Supplier Catalog Number: CNA17968P
Alternative Catalog Number: MBL-CNA17968P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 248-347 of human MT-ND2 (YP_003024027.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 4536
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPTIMATITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL
Target: MT-ND2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200