MT-ND5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17972T
Article Name: MT-ND5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17972T
Supplier Catalog Number: CNA17972T
Alternative Catalog Number: MBL-CNA17972T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 510 to the C-terminus of human MT-ND5 (BAG14520.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 4540
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LTNKLKMKSPLCTFYFSNMLGFYPTITHRTIPYLGLLTSQNLPLLLLDLTWLEKLLPKTISQHQISTSIITSTQKGMIKLYFLSFFFPLILTLLLIT
Target: MT-ND5
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200