OVOL2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA17973T
Article Name: OVOL2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA17973T
Supplier Catalog Number: CNA17973T
Alternative Catalog Number: MBL-CNA17973T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human OVOL2 (NP_067043.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 58495
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAESSSSPHAPESETPEPGDAEGPDGHLATKQ
Target: OVOL2
Application Dilute: WB: WB,1:500 - 1:1000