ZDHHC7 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA17981T
| Article Name: |
ZDHHC7 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA17981T |
| Supplier Catalog Number: |
CNA17981T |
| Alternative Catalog Number: |
MBL-CNA17981T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 210 to the C-terminus of human ZDHHC7 (NP_060210.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
35kDa |
| NCBI: |
55625 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
DFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPRKGGPEFSV |
| Target: |
ZDHHC7 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
