KLK1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1807S
Article Name: KLK1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1807S
Supplier Catalog Number: CNA1807S
Alternative Catalog Number: MBL-CNA1807S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-262 of human KLK1 (NP_002248.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 3816
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Target: KLK1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500