PML Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18134S
Article Name: PML Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18134S
Supplier Catalog Number: CNA18134S
Alternative Catalog Number: MBL-CNA18134S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 510 to the C-terminus of human PML (NP_150243.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 98kDa
NCBI: 5371
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: RPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSVSGPEVQPRTPASPHFRSQGAQPQQVTLRLALRLGNFPVRH
Target: PML
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200