TBCCD1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18143T
Article Name: TBCCD1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18143T
Supplier Catalog Number: CNA18143T
Alternative Catalog Number: MBL-CNA18143T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TBCCD1 (NP_060608.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 55171
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LTPTRPLILSGNQTVTFAPFHTHYPMLEDHMARTGLATVPNYWDNPMVVCRENSDTRVFQLLPPCEFYVFIIPFEMEGDTTEIPGGLPSVYQKALGQREQK
Target: TBCCD1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200