PIN4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18173T
Article Name: PIN4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18173T
Supplier Catalog Number: CNA18173T
Alternative Catalog Number: MBL-CNA18173T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 26-156 of human PIN4 (NP_006214.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 5303
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Target: PIN4
Application Dilute: WB: WB,1:500 - 1:1000