PMP70/ABCD3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18177T
Article Name: PMP70/ABCD3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18177T
Supplier Catalog Number: CNA18177T
Alternative Catalog Number: MBL-CNA18177T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 340-475 of human PMP70/ABCD3 (NP_002849.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 5825
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LSHPRHLKSTHSELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGPN
Target: ABCD3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200