EIF6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1818S
Article Name: EIF6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1818S
Supplier Catalog Number: CNA1818S
Alternative Catalog Number: MBL-CNA1818S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human EIF6 (NP_852133.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 3692
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
Target: EIF6
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200