M1-linkage Specific Polyubiquitin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18200T
Article Name: M1-linkage Specific Polyubiquitin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18200T
Supplier Catalog Number: CNA18200T
Alternative Catalog Number: MBL-CNA18200T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: DOT, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human M1-linkage Specific Polyubiquitin (NP_066289.3/NP_061828.1).
Conjugation: Unconjugated
Clonality: Polyclonal
NCBI: 7314
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
Target: UBB
Application Dilute: WB: WB,1:500 - 1:2000|DB,1:500 - 1:1000