CXCL12 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18225P
Article Name: CXCL12 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18225P
Supplier Catalog Number: CNA18225P
Alternative Catalog Number: MBL-CNA18225P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40 to the C-terminus of human CXCL12 (NP_000600.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 6387
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: ARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Target: CXCL12
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200