ZHX2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18235T
Article Name: ZHX2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18235T
Supplier Catalog Number: CNA18235T
Alternative Catalog Number: MBL-CNA18235T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 488-837 of human ZHX2 (NP_055758.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 92kDa
NCBI: 22882
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SDHRYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPSPAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEED
Target: ZHX2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200