Src Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18240T
Article Name: Src Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18240T
Supplier Catalog Number: CNA18240T
Alternative Catalog Number: MBL-CNA18240T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-536 of human Src (NP_005408.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 6714
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Target: SRC
Application Dilute: WB: WB,1:500 - 1:2000