[KO Validated] ATM Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18257T
Article Name: [KO Validated] ATM Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18257T
Supplier Catalog Number: CNA18257T
Alternative Catalog Number: MBL-CNA18257T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2320-2566 of ATM (NP_000042.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 351kDa
NCBI: 472
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DASCAANNPSLKLTYTECLRVCGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANA
Target: ATM
Application Dilute: WB: WB,1:100 - 1:500