GluR1/GRIA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1826T
Article Name: GluR1/GRIA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1826T
Supplier Catalog Number: CNA1826T
Alternative Catalog Number: MBL-CNA1826T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 330-470 of human GluR1/GRIA1 (NP_000818.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 102kDa
NCBI: 2890
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPD
Target: GRIA1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200