BCAR1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18270T
Article Name: BCAR1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18270T
Supplier Catalog Number: CNA18270T
Alternative Catalog Number: MBL-CNA18270T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 495-612 of human BCAR1 (NP_055382.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 9564
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATA
Target: BCAR1
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200