ATP5G2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18279T
Article Name: ATP5G2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18279T
Supplier Catalog Number: CNA18279T
Alternative Catalog Number: MBL-CNA18279T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ATP5G2 (NP_001002031.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 517
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGT
Target: ATP5MC2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200