Peroxiredoxin 4 (PRDX4) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18308T
Article Name: Peroxiredoxin 4 (PRDX4) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18308T
Supplier Catalog Number: CNA18308T
Alternative Catalog Number: MBL-CNA18308T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-100 of human Peroxiredoxin 4 (PRDX4) (NP_006397.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 10549
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: TEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKE
Target: PRDX4
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200