DIP2C Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18352T
Article Name: DIP2C Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18352T
Supplier Catalog Number: CNA18352T
Alternative Catalog Number: MBL-CNA18352T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human DIP2C (NP_055789.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 171kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: LAKHKERKMAVPMPSKRRSLVVQTSMDAYTPPDTSSGSEDEGSVQGDSQGTPTSSQGSINMEHWISQAIHGSTTSTTSSSSTQSGGSGAAHRLADVMAQTHIENHSAPPDVTTYTSEHSIQVERPQGSTGSRTAPKYGNAELMETGDGVPVSSRVSAKIQQ
Target: DIP2C
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200