PRK2/PKN2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA18373T
| Article Name: |
PRK2/PKN2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA18373T |
| Supplier Catalog Number: |
CNA18373T |
| Alternative Catalog Number: |
MBL-CNA18373T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 600-700 of human PRK2/PRK2/PKN2 (NP_006247.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
112kDa |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
GQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVD |
| Target: |
PKN2 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
