REPIN1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18451T
Article Name: REPIN1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18451T
Supplier Catalog Number: CNA18451T
Alternative Catalog Number: MBL-CNA18451T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 376-567 of human REPIN1 (NP_037532.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 64kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SCDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLAHQKKHDV
Target: REPIN1
Application Dilute: WB: WB,1:500 - 1:2000