Topors Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA18526T
Article Name: |
Topors Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA18526T |
Supplier Catalog Number: |
CNA18526T |
Alternative Catalog Number: |
MBL-CNA18526T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse Topors (NP_598858.2). |
Conjugation: |
Unconjugated |
Clonality: |
Polyclonal |
Molecular Weight: |
117kDa |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
PDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFTNPEVRRFRYRTTMTRERSASLYSPSST |
Target: |
Topors |
Application Dilute: |
WB: WB,1:500 - 1:2000 |