SLC26A9 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA18530T
| Article Name: |
SLC26A9 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA18530T |
| Supplier Catalog Number: |
CNA18530T |
| Alternative Catalog Number: |
MBL-CNA18530T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 500-660 of human SLC26A9 (NP_443166.1). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
87kDa |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
RNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENAPPTDPNNNQTPANGTSVSYITFSPDSSSPAQSEPPASAEAPGEPSDMLASVPPFV |
| Target: |
SLC26A9 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
