ANKRD46 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18552T
Article Name: ANKRD46 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18552T
Supplier Catalog Number: CNA18552T
Alternative Catalog Number: MBL-CNA18552T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-232 of human ANKRD46 (NP_001257308.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 25kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVEDLGFWRVLLLIFVIALLSLGIAYYRRTLRLGSFARQDRSRIQAI
Target: ANKRD46
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200