FAAH2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18554T
Article Name: FAAH2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18554T
Supplier Catalog Number: CNA18554T
Alternative Catalog Number: MBL-CNA18554T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 323-532 of human FAAH2 (NP_777572.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 58kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DQDLIMTQKKVVVHLETILGASVQHVKLKKMKYSFQLWIAMMSAKGHDGKEPVKFVDLLGDHGKHVSPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKELVDMLGDDGVFLYPSHPTVAPKHHVPLTRPFNFAYTGVFSALGLPVTQCPLGLNAKGLPLGIQVVAGPFNDHLTLAVAQYLEKTFGGWVCPGKF
Target: FAAH2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200