PRKG2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA18575T
Article Name: PRKG2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA18575T
Supplier Catalog Number: CNA18575T
Alternative Catalog Number: MBL-CNA18575T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human PRKG2 (NP_006250.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 87kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLIT
Target: PRKG2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000