HNF3beta/FOXA2 Rabbit mAb, Clone: [ARC0391], Unconjugated, Monoclonal

Catalog Number: MBL-CNA19053S
Article Name: HNF3beta/FOXA2 Rabbit mAb, Clone: [ARC0391], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA19053S
Supplier Catalog Number: CNA19053S
Alternative Catalog Number: MBL-CNA19053S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HNF3beta/FOXA2 (Q9Y261).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0391]
Molecular Weight: 48kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVA
Target: FOXA2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200